ASFVdb The African Swine Fever Virus Database
Strain
South_Africa_KNP_Pretorisuskop_1996 (Region: South Africa, Kruger National Park;  Strain: Pretorisuskop/96/4;  Date: 1996)
Gene
hypothetical protein ASFV_Kyiv_2016_131_00173
Description
With frameshift mutation but translatable,  hypothetical protein
GenBank Accession
 

Sequence

CDS
ATGGCGTATCCCGAATTGGATGCCGCAGACTTTTTGCAACAGTTGGCGCGAAGAAAGGAGTTTAAGTCGTTGATTTCCCCTCCTGTCGACCAAAAAGAGCTCATTCGTGATCTGCGGGCTCATTTTGTCCAGATCGGTGGGCCTGGCTGCGAGAAGGGGGGGCGAGCGTTTTTTCCGTGTGACCCCTACGCGTCGCCCTTTCCTTCCATCAAGGGTCTCCAATTGCATAATGCCCAGCTTTTCGTCCAAAACTTTCAAAACCCCAACACGCCCTACTCGCGTCTTTTATTA
Protein
MAYPELDAADFLQQLARRKEFKSLISPPVDQKELIRDLRAHFVQIGGPGCEKGGRAFFPCDPYASPFPSIKGLQLHNAQLFVQNFQNPNTPYSRLLL

Summary

ProteinModelPortal
PDB
6RFL     E-value=2.26771e-07,     Score=136

Ontologies

Subcellular Location

From MSLVP
Single-Pass Membrane

Topology

Length:
97
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0002
Exp number, first 60 AAs:
0
Total prob of N-in:
0.14946
outside
1  -  97
 
 

Population Genetic Test Statistics

Pi
0.0272365
Theta
0.031859
Tajima's D
-0.3082978
CLR
0.055867
Interpretation
No evidence of Selection

Multiple alignment of Orthologues

 
 

Gene Tree

 
 

Orthologous in Strains

Strain Availability Status Gene
Spain_BA71_1971 Protein
Protein
Protein
QED21706.1
QED21709.1
AKO62787.1
China_AnhuiXCGQ_2018 Protein
Protein
Protein
QED21706.1
QED21709.1
AYW34077.1
China_ASFV-SY18_2018 Protein
AKO62787.1
Poland_Pol16_20186_o7_2016-2017 Protein
Protein
Protein
QED21706.1
QED21709.1
AXZ95880.1
Poland_Pol16_20538_o9_2016-2017 Protein
Protein
Protein
AJL34119.1
QED21706.1
QED21709.1
Poland_Pol16_20540_o10_2016-2017 Protein
Protein
Protein
AJL34119.1
QED21706.1
QED21709.1
Poland_Pol16_29413_o23_2016-2017 Protein
Protein
Protein
AJL34119.1
QED21706.1
QED21709.1
Poland_Pol17_03029_C201_2016-2017 Protein
Protein
Protein
AJL34119.1
QED21706.1
QED21709.1
Poland_Pol17_04461_C210_2016-2017 Protein
Protein
Protein
QED21706.1
QED21709.1
AXZ96163.1
Poland_Pol17_05838_C220_2016-2017 Protein
Protein
Protein
AJL34119.1
QED21706.1
QED21709.1
Poland_ASFV_POL_Podlaskie_2015 Protein
Protein
Protein
AJL34119.1
QED21706.1
QED21709.1
Uganda_R8_2015 Protein
Protein
Protein
QED21706.1
QED21709.1
AXB49334.1
Uganda_R7_2015 Protein
Protein
Protein
QED21706.1
QED21709.1
AXB49508.1
Uganda_R25_2015 Protein
Protein
Protein
QED21706.1
QED21709.1
AXB49680.1
Uganda_N10_2015 Protein
Protein
Protein
QED21706.1
QED21709.1
AXB49851.1
Uganda_R35_2015 Protein
Protein
Protein
QED21706.1
QED21709.1
AXB50024.1
Estonia_2014 Protein
Protein
Protein
QED21706.1
QED21709.1
SPS73529.1
Italy_26544_OG10_2010 Protein
Protein
Protein
QED21706.1
QED21709.1
AJZ77045.1
Italy_47_Ss_2008_2008 Protein
Protein
Protein
QED21706.1
QED21709.1
AOO54464.1
Portugal_OURT_88.3_1988 Protein
Protein
Protein
QED21706.1
QED21709.1
CAN10455.1
Spain_E75_1975 Protein
Protein
QED21706.1
CBH29206.1
Russia_Georgia_2007 Protein
Protein
Protein
QED21706.1
QED21709.1
CBW46772.1
Kenya_Tk1_2005 Protein
Protein
Protein
Protein
AJL34119.1
QED21706.1
QED21709.1
AJL34119.1
Kenya_Bus_2006 Protein
Protein
Protein
QED21706.1
QED21709.1
AJL34284.1
Russia_Odintsovo_2014 Protein
Protein
Protein
AJL34119.1
QED21706.1
QED21709.1
Portugal_L60_1960 Protein
Protein
Protein
QED21706.1
QED21709.1
AIY22297.1
Portugal_NHV_1968 Protein
Protein
Protein
QED21706.1
QED21709.1
AIY22455.1
Russia_Kashino_2013 Protein
Protein
Protein
AJL34119.1
QED21706.1
QED21709.1
Benin_1997 Protein
Protein
Protein
QED21706.1
QED21709.1
CAN10205.1
South_Africa_KNP_Pretorisuskop_1996 Protein
Protein
Protein
AJL34119.1
QED21706.1
QED21709.1
South_Africa_MGR_Mkuzi_1979 Protein
Protein
Protein
AJL34119.1
QED21706.1
QED21709.1
Malawi_Lil_1983 Protein
QED21706.1
Kenya_1950 Protein
Protein
Protein
AJL34119.1
QED21706.1
QED21709.1
Namibia_Warthog_1980 Protein
Protein
Protein
AJL34119.1
QED21706.1
QED21709.1
South_Africa_Warmbaths_1987 Genetic Remain
Protein
Protein
AJL34119.1
QED21706.1
QED21709.1
Malawi_Tengani_1962 Protein
Protein
Protein
AJL34119.1
QED21706.1
QED21709.1
China_HLJ_2018 Protein
Protein
QED21709.1
QBH90594.1
China_LN_2018 Protein
Protein
QED21709.1
QBH90779.1
China_wbBS01_2018 Protein
Protein
Protein
QED21706.1
QED21709.1
QDL88137.1
Ukraine_Kyiv_2014 Protein
Protein
QED21707.1
QED21708.1
Belgium_Etalle_wb_2018 Protein
Protein
Protein
QED21706.1
QED21709.1
QED90549.1
Lithuania_LT14_2014 Protein
Protein
Protein
QED21706.1
QED21709.1
QEY87912.1
South_Africa_1985 Protein
Protein
Protein
AJL34119.1
QED21706.1
QED21709.1
South_Africa_2_2008 Protein
Protein
Protein
AJL34119.1
QED21706.1
QED21709.1
Zambia_LIV_1983 Protein
Protein
QED21706.1
QED21709.1
Copyright@ 2018-2023    Any Comments and suggestions mail to:  zhuzl@cqu.edu.cn, mg@cau.edu.cn   渝ICP备19006517号

渝公网安备 50010602502065号

In processing...
Login to ASFVdb
Email
Password
Please go to Regist if without an account.
If you have forgotten your password, you can once again Regist an account with a registed or new email.
Change my password
Enter new password
Reenter new password
Regist an account of ASFVdb
It is required that you provide your institutional e-mail address (with edu or org in the domain) as confirmation of your affiliation.
Enter email
Reenter email
First Name
Last Name
Institution
You can directly go to if with an account.
Registraion Success
Your password has been sent to your email.
Please check it and login later.
Welcome to use ASFVdb.