ASFVdb The African Swine Fever Virus Database
Strain
Russia_Georgia_2007 (Region: Russia;  Strain: Georgia 2007/1;  Date: 2007)
Gene
MGF_505-1R
Description
Annotated in NCBI,  member of multigene family 505
GenBank Accession
Full name
Protein MGF 505-1R       + More
Protein MGF 505-3R      
Protein MGF 505-4R      
Protein MGF 505-5R      
Protein MGF 505-2R      
Protein MGF 505-10R      
Protein MGF 505-7R      
Protein MGF 505-6R      
 

Sequence

CDS
ATGTTCTCTCTCCAGAACTTATGTCGAAAAACATTACCTAACCGTAAACTTCCTGAATTTTTTGACGAATATATATTACAACTGCTGGGATTATACTGGGAAAACCATGGAACTATTCAACGAGCAGGAAACAACTGTGTGCTTATACAGCAACATACCCTCATTCCCGTAAATGAAGCCCTGAGAACAGCAGCATCTGAAGAAAATTATGAGATCGTGAGCCTTTTATTAGCGTGGGAGGGGAACCTTTACTATGCTATTATAGGGGCTCTAGAGGGCAACCGCCACGACTTAATTCGTAAATATGATGACCAAATCAAGGACCATCATGAAATTCTGCCATTCATTGACGATCCAGTCATATTTCACAAATGCCATATCATGCGGCAATGCTTTTTTGATTGTATTTTATATCAAGCTGTAAAATATAGTAAGTTTCGCGTTCTTCTTTACTTTAAACATAGATTAGAGGATGATTTGCCCTTCACTCATTTACTTATTGAAAAGGCATGTAAAGATCATAATTATGAAGTTATTAAATGGATATATGAAAACCTACATATCTACAATATGATAGATACCTTTGAATGTGCTATTGCCCATAAGGATCTACATCTATATTGTTTGGGGTATAGATTTATATATAACAGAATCGTACCCGATAAGTATCATCATTTAGATATTCGCATGCTTTCAAGCCTACAACTCCTACATAAGGTGGCAGCCAAAGGATACTTAGATTTTATCCTAGAAACCTTAAAGTATGATCATAATAAAGATAATATAAATATTATTCTAACACAAGCTGCAACCTATAACCATAGAAAAATTTTAATCTATTTCATTCCTCAATCAACCCACGCACAGATAGAACAATGTTTACTAGTGGCGATAAAAGCAAAATCTTCCAGGAAAACCTTGAACTTACTACTGTCTCACCTAAACCTTTCCATCAACCTCATCAAAAAAATAAGCCATTATGTTGCCACTTACAATTCAACAAATATAATAGGCATTCTGAGTATGCGGCGGAAAAAGAAGATATATTTAGATATCATATTGACAAAATTTGTAAAAAAAGCTATTTTTAATAAGTTTGTCGTTCGATGTATGGATACATTTTCTATAAACCCGGAAAGAATCCTTAAAATAGCCGCGCGAATAAATAGGATGATGTTAGTGAAAAAAATATCTGAACATGTTTGGAAAAATCATGCGGTTAGACTTAAATACCTTAAACATGCGGTACACACGATGAAGCATAAAGATGGGAAAAATAGACTCATGAACTTTATCTATGATCGCTGTTATTACCATATGCAAGGGGAAGAAATCTTTAGCCTCGCAAGATTTTATGCAATCCATCATGCACCAAAGTTGTTTGACGTTTTTTATGATTGTTGTATCCTAGATACGATACGATTCAAAAGCCTTCTTTTAGATTGTTCACATATCATAGGTAAAAACGCTCATGATGCTACCAATATCAACATCGTGAACAAGTATATCGGCAACCTGTTTGTTATGGGAGTTCTTAGCAAAAAAGAAATCTTACAGGACTATCCATCCATTTATTCTAAACAATACATGCCTTAG
Protein
MFSLQNLCRKTLPNRKLPEFFDEYILQLLGLYWENHGTIQRAGNNCVLIQQHTLIPVNEALRTAASEENYEIVSLLLAWEGNLYYAIIGALEGNRHDLIRKYDDQIKDHHEILPFIDDPVIFHKCHIMRQCFFDCILYQAVKYSKFRVLLYFKHRLEDDLPFTHLLIEKACKDHNYEVIKWIYENLHIYNMIDTFECAIAHKDLHLYCLGYRFIYNRIVPDKYHHLDIRMLSSLQLLHKVAAKGYLDFILETLKYDHNKDNINIILTQAATYNHRKILIYFIPQSTHAQIEQCLLVAIKAKSSRKTLNLLLSHLNLSINLIKKISHYVATYNSTNIIGILSMRRKKKIYLDIILTKFVKKAIFNKFVVRCMDTFSINPERILKIAARINRMMLVKKISEHVWKNHAVRLKYLKHAVHTMKHKDGKNRLMNFIYDRCYYHMQGEEIFSLARFYAIHHAPKLFDVFYDCCILDTIRFKSLLLDCSHIIGKNAHDATNINIVNKYIGNLFVMGVLSKKEILQDYPSIYSKQYMP

Summary

Function
Plays a role in virus cell tropism, and may be required for efficient virus replication in macrophages.
Similarity
Belongs to the asfivirus MGF 505 family.
Keywords
Complete proteome   Reference proteome   ANK repeat   Repeat  
Feature
chain  Protein MGF 505-1R
EMBL
FR682468    CBW46685.1    MG939583    MG939587    MG939588    LS478113    + More
AXZ95798.1    AXZ95986.1    AXZ96081.1    SPS73442.1    AY261366    AY261360    AY261363    AM712239    CAN10120.1    FN557520    CBH29122.1    KM102979    KX354450    AJZ77058.1    AOO54340.1    KM262844    KP055815    AIY22212.1    AKO62703.1    U03762    AY261361    KM111294    AJL34037.1    KM111295    AJL34201.1    MH025916    MH025917    MH025918    MH025919    MH025920    AXB49251.1    AXB49425.1    AXB49597.1    AXB49770.1    AXB49941.1    AJL34042.1    AJL34207.1    AXB49256.1    AXB49430.1    AXB49602.1    AXB49774.1    AXB49946.1    CBW46690.1    AXZ95803.1    AXZ95991.1    AXZ96086.1    SPS73447.1    AJZ77106.1    AOO54351.1    CAN10125.1    CBH29127.1    AIY22217.1    AKO62708.1    U02468    U18466    CAN10126.1    CBH29128.1    AM712240    CAN10375.1    KM262845    AIY22218.1    AIY22377.1    AJZ77065.1    AKO62709.1    AOO54353.1    CBW46692.1    AXZ95993.1    AXZ96088.1    SPS73449.1    CAN10376.1    AIY22378.1    AJL34208.1    AXB49257.1    AXB49431.1    AXB49603.1    AXB49947.1    AJL34043.1    AJL34209.1    AXB49258.1    AXB49432.1    AXB49604.1    AXB49775.1    AXB49948.1    AXZ95805.1    AXZ95806.1    AXZ95994.1    AXZ96089.1    CBW46693.1    SPS73450.1    CAN10127.1    CBH29129.1    AIY22219.1    AJZ77066.1    AKO62710.1    AOO54354.1    AJL34044.1    AXB49255.1    AXB49429.1    AXB49601.1    AXB49773.1    AXB49945.1    AJL34206.1    CBW46689.1    AXZ95802.1    AXZ95990.1    AXZ96085.1    SPS73446.1    CAN10124.1    AIY22216.1    AJZ77062.1    AKO62707.1    AOO54349.1    AJL34047.1    AJL34212.1    AXB49261.1    AXB49435.1    AXB49607.1    AXB49778.1    AXB49951.1    CBH29126.1    CBH29133.1    AJZ77055.1    AOO54359.1    AIY22223.1    AKO62714.1    CAN10380.1    AIY22382.1    CAN10131.1    AJL34041.1    CBW46697.1    AXZ95809.1    AXZ95997.1    AXZ96092.1    SPS73454.1    U03761    CBW46695.1    SPS73452.1    AKO62712.1    AJL34045.1    AOO54356.1    CBH29131.1    CAN10129.1    AIY22221.1    AJZ77061.1    CBW46694.1    AXZ95807.1    AXZ95995.1    AXZ96090.1    SPS73451.1    CAN10378.1   
Pfam
PF03158   DUF249
Interpro
IPR004858   MGF_505
IPR036770   Ankyrin_rpt-contain_sf
SUPFAM
SSF48403   SSF48403
PDB
3J6H     E-value=5.14091,     Score=70

Ontologies

Subcellular Location

From MSLVP
Cytoplasm

Topology

Length:
531
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.443969999999999
Exp number, first 60 AAs:
0.00053
Total prob of N-in:
0.01882
outside
1  -  531
 
 

Population Genetic Test Statistics

Pi
0.0920695
Theta
0.1341965
Tajima's D
-1.1860195
CLR
0
Interpretation
No evidence of Selection

Multiple alignment of Orthologues

 
 

Gene Tree

 
 

Orthologous in Strains

Strain Availability Status Gene
Spain_BA71_1971    
China_AnhuiXCGQ_2018 Protein
AYW33991.1
China_ASFV-SY18_2018    
Poland_Pol16_20186_o7_2016-2017 Protein
AXZ95798.1
Poland_Pol16_20538_o9_2016-2017    
Poland_Pol16_20540_o10_2016-2017    
Poland_Pol16_29413_o23_2016-2017    
Poland_Pol17_03029_C201_2016-2017 Protein
AXZ95986.1
Poland_Pol17_04461_C210_2016-2017 Protein
AXZ96081.1
Poland_Pol17_05838_C220_2016-2017    
Poland_ASFV_POL_Podlaskie_2015    
Uganda_R8_2015 Protein
AXB49251.1
Uganda_R7_2015 Protein
AXB49425.1
Uganda_R25_2015 Protein
AXB49597.1
Uganda_N10_2015 Protein
AXB49770.1
Uganda_R35_2015 Protein
AXB49941.1
Estonia_2014 Protein
SPS73442.1
Italy_26544_OG10_2010    
Italy_47_Ss_2008_2008    
Portugal_OURT_88.3_1988    
Spain_E75_1975    
Russia_Georgia_2007 Protein
CBW46685.1
Kenya_Tk1_2005 Protein
AJL34037.1
Kenya_Bus_2006 Protein
AJL34201.1
Russia_Odintsovo_2014    
Portugal_L60_1960    
Portugal_NHV_1968    
Russia_Kashino_2013    
Benin_1997 Protein
CAN10120.1
South_Africa_KNP_Pretorisuskop_1996 Protein
CAN10120.1
South_Africa_MGR_Mkuzi_1979 Protein
CAN10120.1
Malawi_Lil_1983 Protein
CAN10120.1
Kenya_1950 Protein
CAN10120.1
Namibia_Warthog_1980 Protein
CAN10120.1
South_Africa_Warmbaths_1987 Protein
CAN10120.1
Malawi_Tengani_1962 Protein
CAN10120.1
China_HLJ_2018 Protein
QBH90507.1
China_LN_2018 Protein
QBH90692.1
China_wbBS01_2018 Protein
QDL88050.1
Ukraine_Kyiv_2014 Protein
Protein
QED21575.1
QED21575.1
Belgium_Etalle_wb_2018 Protein
QED90462.1
Lithuania_LT14_2014 Protein
QEY87825.1
South_Africa_1985 Protein
QGM12888.1
South_Africa_2_2008 Protein
QGM12810.1
Zambia_LIV_1983    
Copyright@ 2018-2023    Any Comments and suggestions mail to:  zhuzl@cqu.edu.cn, mg@cau.edu.cn   渝ICP备19006517号

渝公网安备 50010602502065号

In processing...
Login to ASFVdb
Email
Password
Please go to Regist if without an account.
If you have forgotten your password, you can once again Regist an account with a registed or new email.
Change my password
Enter new password
Reenter new password
Regist an account of ASFVdb
It is required that you provide your institutional e-mail address (with edu or org in the domain) as confirmation of your affiliation.
Enter email
Reenter email
First Name
Last Name
Institution
You can directly go to if with an account.
Registraion Success
Your password has been sent to your email.
Please check it and login later.
Welcome to use ASFVdb.