ASFVdb The African Swine Fever Virus Database
Strain
China_HLJ_2018 (Region: China, Heilongjiang;  Strain: Pig/HLJ/2018;  Date: 2018)
Gene
C962R
Description
With frameshift mutation but translatable,  C962R
GenBank Accession
Full name
Putative helicase C962R      
 

Sequence

CDS
ATGCGCGAGGAATCATGGGAAGACCACGATACCATTCAGCTCACCGCTCAGCGCAAATACCTCGCCGAGGTGCAAGCTCTAGAGACCCTTTTGACTCGAGAGCTTTCAGTCTTTCTCACAGAGCCAGGCAGCAAAAAAACAAATATTATTAATAGAATCACAGGAAAAACCTACGCACTTCCCAGCACAGAGCTACTAAGACTCTACGAGCATCTCGAGCAATGTCGCAAGCAAGGCGCCCTCATGTATTTTTTGGAAAGACAGGGGACCTACTCGGGTCTCATGTTGGACTATGACCTTAAACTCAATACAAATGCTGTTCCCCCGCTGGAACCCCCCGCGCTATCACGGCTTTGCCATCGAATATTTGTGCATATA
Protein
MREESWEDHDTIQLTAQRKYLAEVQALETLLTRELSVFLTEPGSKKTNIINRITGKTYALPSTELLRLYEHLEQCRKQGALMYFLERQGTYSGLMLDYDLKLNTNAVPPLEPPALSRLCHRIFVHI

Summary

Similarity
Belongs to the asfivirus helicase C962R family.
Keywords
ATP-binding   Complete proteome   DNA replication   Helicase   Hydrolase   Nucleotide-binding   Reference proteome  
Feature
chain  Putative helicase C962R
Pfam
PF08706   D5_N
PF08707   PriCT_2
Interpro
IPR014818   Phage/plasmid_primase_P4_C
IPR014015   Helicase_SF3_DNA-vir
IPR027417   P-loop_NTPase
IPR014819   PriCT_2
SUPFAM
SSF52540   SSF52540
PDB
5X42     E-value=2.94147,     Score=74

Ontologies

KEGG

Subcellular Location

From MSLVP
Single-Pass Membrane

Topology

Length:
126
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00219
Exp number, first 60 AAs:
0.00145
Total prob of N-in:
0.28361
outside
1  -  126
 
 

Population Genetic Test Statistics

Pi
0.0224936
Theta
0.0352725
Tajima's D
-0.9249644
CLR
0.283058
Interpretation
No evidence of Selection

Multiple alignment of Orthologues

 
 

Gene Tree

 
 

Orthologous in Strains

Strain Availability Status Gene
Spain_BA71_1971 Protein
Protein
QED21643.1
AKO62753.1
China_AnhuiXCGQ_2018 Protein
Protein
QED21643.1
AYW34042.1
China_ASFV-SY18_2018 Protein
Protein
Protein
CBH29172.1
CBH29173.1
AKO62753.1
Poland_Pol16_20186_o7_2016-2017 Protein
Protein
QED21643.1
AXZ95845.1
Poland_Pol16_20538_o9_2016-2017 Protein
Protein
CAN10171.1
QED21643.1
Poland_Pol16_20540_o10_2016-2017 Protein
Protein
CAN10171.1
QED21643.1
Poland_Pol16_29413_o23_2016-2017 Protein
Protein
CAN10171.1
QED21643.1
Poland_Pol17_03029_C201_2016-2017 Protein
Protein
QED21643.1
AXZ96033.1
Poland_Pol17_04461_C210_2016-2017 Protein
Protein
QED21643.1
AXZ96128.1
Poland_Pol17_05838_C220_2016-2017 Protein
Protein
CAN10171.1
QED21643.1
Poland_ASFV_POL_Podlaskie_2015 Protein
Protein
CAN10171.1
QED21643.1
Uganda_R8_2015 Protein
Protein
QED21643.1
AXB49300.1
Uganda_R7_2015 Protein
Protein
QED21643.1
AXB49474.1
Uganda_R25_2015 Protein
Protein
QED21643.1
AXB49646.1
Uganda_N10_2015 Protein
Protein
QED21643.1
AXB49817.1
Uganda_R35_2015 Protein
Protein
QED21643.1
AXB49990.1
Estonia_2014 Protein
Protein
QED21643.1
SPS73494.1
Italy_26544_OG10_2010 Protein
Protein
QED21643.1
AJZ77047.1
Italy_47_Ss_2008_2008 Protein
Protein
Protein
QED21643.1
AOO54407.1
AOO54408.1
Portugal_OURT_88.3_1988 Protein
Protein
QED21643.1
CAN10420.1
Spain_E75_1975 Protein
Protein
CBH29172.1
CBH29173.1
Russia_Georgia_2007 Protein
Protein
QED21643.1
CBW46737.1
Kenya_Tk1_2005 Protein
Protein
QED21643.1
AJL34085.1
Kenya_Bus_2006 Protein
Protein
QED21643.1
AJL34250.1
Russia_Odintsovo_2014 Protein
Protein
CAN10171.1
QED21643.1
Portugal_L60_1960 Protein
Protein
QED21643.1
AIY22263.1
Portugal_NHV_1968 Protein
Protein
QED21643.1
AIY22421.1
Russia_Kashino_2013 Protein
Protein
CAN10171.1
QED21643.1
Benin_1997 Protein
Protein
Protein
CAN10171.1
QED21643.1
CAN10171.1
South_Africa_KNP_Pretorisuskop_1996 Protein
Protein
CAN10171.1
QED21643.1
South_Africa_MGR_Mkuzi_1979 Protein
Protein
CAN10171.1
QED21643.1
Malawi_Lil_1983 Protein
Protein
CAN10171.1
QED21643.1
Kenya_1950 Protein
Protein
CAN10171.1
QED21643.1
Namibia_Warthog_1980 Protein
Protein
CAN10171.1
QED21643.1
South_Africa_Warmbaths_1987 Protein
Protein
CAN10171.1
QED21643.1
Malawi_Tengani_1962 Protein
Protein
CAN10171.1
QED21643.1
China_HLJ_2018 Protein
Protein
QED21643.1
QBH90559.1
China_LN_2018 Protein
Protein
QED21643.1
QBH90744.1
China_wbBS01_2018 Protein
Protein
QED21643.1
QDL88102.1
Ukraine_Kyiv_2014 Protein
Protein
Protein
QED21643.1
QED21644.1
QED21645.1
Belgium_Etalle_wb_2018 Protein
Protein
QED21643.1
QED90514.1
Lithuania_LT14_2014 Protein
Protein
QED21643.1
QEY87877.1
South_Africa_1985 Protein
Protein
QED21643.1
QGM12919.1
South_Africa_2_2008 Protein
Protein
QED21643.1
QGM12844.1
Zambia_LIV_1983 Protein
QED21643.1
Copyright@ 2018-2023    Any Comments and suggestions mail to:  zhuzl@cqu.edu.cn, mg@cau.edu.cn   渝ICP备19006517号

渝公网安备 50010602502065号

In processing...
Login to ASFVdb
Email
Password
Please go to Regist if without an account.
If you have forgotten your password, you can once again Regist an account with a registed or new email.
Change my password
Enter new password
Reenter new password
Regist an account of ASFVdb
It is required that you provide your institutional e-mail address (with edu or org in the domain) as confirmation of your affiliation.
Enter email
Reenter email
First Name
Last Name
Institution
You can directly go to if with an account.
Registraion Success
Your password has been sent to your email.
Please check it and login later.
Welcome to use ASFVdb.